Recombinant Mouse NAD (P)H dehydrogenase [quinone] 1 (Nqo1)

In Stock Promotion
Code CSB-YP717562MO
Abbreviation Recombinant Mouse Nqo1 protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Nqo1
Uniprot No.
Research Area
Metabolism
Alternative Names
Nqo1; Dia4; Nmo1; Nmor1; NAD(P)H dehydrogenase [quinone] 1; EC 1.6.5.2; Azoreductase; DT-diaphorase; DTD; Menadione reductase; NAD(P)H:quinone oxidoreductase 1; Phylloquinone reductase; Quinone reductase 1; QR1
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
2-274aa
Target Protein Sequence
AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
Gene References into Functions
  1. Although the exact role of NQO1 in prostatic hyperplasia remains unclear, the hyperplasia exacerbation due to NQO1 deletion might be independent of type 2 5alpha-reductase and might be related to enhanced androgen receptor affinity due to enhanced HSP90-alpha expression. PMID: 29110315
  2. Novel RNA-binding activity of NQO1 promotes SERPINA1 mRNA translation. PMID: 27515817
  3. NQO1 and autophagy participate in a protective role in cisplatin injury. PMID: 26935540
  4. Miroestrol restored hepatic NQO1 expression in beta-naphthoflavone-treated mice. PMID: 26893163
  5. previous and present results collectively show that NQO1 is involved in the formation of tight junctions in the small intestine, and that defects in NQO1 enhance C. difficile toxin A-induced acute inflammatory responses, presumably via the loss of epithelial cell tight junctions PMID: 27116994
  6. NQO1 plays a critical role in protection against energy depletion in acetaminophen-induced liver injury, and is associated with improvement of mitochondrial dysfunction PMID: 25224400
  7. The present results demonstrate that exacerbated cisplatin-induced nephrotoxicity under the NQO1-knockout condition was accompanied by the reduced expression of MRN complex proteins, ATM, PARP1, and Sirt1. PMID: 26723870
  8. We defined the basal and butylated hydroxyanisole induced expression patterns of Nqo1, AKR1B8, and Ho-1 in the liver and small intestine of C57BL/6 mice. PMID: 26291391
  9. The colons of NQO1-KO mice also showed high levels of reactive oxygen species (ROS) and histone deacetylase (HDAC) activity, which are known to affect transcriptional regulation. PMID: 24393524
  10. induction by humulusol PMID: 24397993
  11. the induction of cellular NAD(+) levels using beta-lapachone (beta-Lap), whose intracellular target is NQO1, prevents the toxic effects of cisplatin through the regulation of PARP-1 and SIRT1 activity. PMID: 24922076
  12. Nqo1 expression is protective against renal ischemia/reperfusion injury in mice. PMID: 24189322
  13. results indicate that AAI can increase its own metabolic activation by inducing NQO1, thereby enhancing its own genotoxic potential. PMID: 24769487
  14. PCB-77 induced reductions in insulin signaling in adipose tissue were also abolished by Resveratrol, which increased NQO1 expression. PMID: 24231106
  15. NQO1 does not play a major role in the production of vitamin K hydroquinone and supports the existence of multiple vitamin K reduction pathways. PMID: 24015818
  16. NQO1 protects cells against renal failure induced by cisplatin; this effect is mediated by decreased NOX activity via cellular NADPH/NADP modulation. PMID: 23831944
  17. findings link NQO1, a cellular redox sensor, to the metabolite-sensing network that tunes PGC-1alpha expression and activity in regulating energy metabolism PMID: 23648480
  18. In the present study we show that [a] NQO1 protein locates to cytosol, ER and mitochondria. PMID: 23692925
  19. the results demonstrate for the first time that NQO1 is an endogenous factor in protection against painful bladder syndrome PMID: 22985937
  20. NADPH:quinone oxidoreductase 1 regulates host susceptibility to ozone via isoprostane generation PMID: 23275341
  21. hypertrophy is negatively regulated by NQO1 activity mouse 3T3-L1 adipocytes. PMID: 22683604
  22. NAD(P)H quinone oxidoreductase 1 regulates neutrophil elastase-induced mucous cell metaplasia. PMID: 22659878
  23. expression in cochlea did not decrease with age PMID: 21631178
  24. PGI synthase overexpression protects against bleomycin-induced mortality and is associated with increased Nqo 1 expression. PMID: 21764988
  25. NQO1 plays an important role in renal AAI nitroreduction and may thus contribute to AAI-induced nephrotoxicity. PMID: 21613233
  26. catalase overexpression upregulates BaP-induced NQO1 expression by enhancing the Sp1-AhR-Nrf2 signaling cascade. PMID: 21569840
  27. NQO1 activation has a hypotensive effect mediated by eNOS activation via cellular NAD(+)/NADH ratio modulation in an animal model. PMID: 21502369
  28. Hyperhomocysteinemia leads to a decrease of hepatic Nqo1 gene expression and activity with a reversal effect of wine polyphenol extract supplementation. PMID: 21550378
  29. Plasma membrane electron transport in pancreatic beta-cells is mediated in part by NQO1. PMID: 21505151
  30. findings assign NQO1 an original role in the regulation of mRNA translation via the control of eukaryotic translation initiation factor 4GI stability by the proteasome. PMID: 20028737
  31. NQO1 regulates p53 proteasomal degradation independently of MDM2 and ubiquitin. PMID: 12232053
  32. Induction of NQO1 activity exaggerates neuronal damage in a mouse focal cerebral ischaemia model PMID: 12603827
  33. NQO1 has an important role in stabilizing hot-spot p53 mutant proteins in cancer PMID: 14634213
  34. A role is suggested for NQO1 in myelination in the central nervous system or in the insulating/wrapping function of glial cells. PMID: 14991562
  35. These results indicate that one division of both the accessory and the main olfactory projection maps are composed of sensory neurons that are specialized to reduce environmental and/or endogenously produced quinones via an NQO1-dependent mechanism. PMID: 15128404
  36. NQO1 has a role in regulating ubiquitin-independent degradation of ornithine decarboxylase by the 20S proteasome PMID: 15749015
  37. This is the first demonstration that heavy metals (mercury, lead and copper) regulate the expression of Noqo1 gene through a transcriptonal mechanism. PMID: 16243960
  38. NQO1 plays a pivotal role in signaling activated by TNF and other inflammatory stimuli and that its suppression is a potential therapeutic strategy for tumor cells. PMID: 16682409
  39. NQO1 and NQO2 are endogenous factors in the regulation of immune response and autoimmunity PMID: 16905546
  40. NOS2 induction and NO production may be involved in TNF-alpha- and LPS-mediated downregulation of Cyp1a1 without affecting the downregulation of Nqo1. PMID: 17588258
  41. A major in vivo role of NQO1 in metabolic activation of mitomycin C with implications in mitomycin C chemotherapy. PMID: 17804703
  42. Bach1 repression of ferritin and thioredoxin reductase1 is heme-sensitive in cells and in vitro and coordinates expression with heme oxygenase1, beta-globin, and NADP(H) quinone (oxido) reductase1. PMID: 17901053
  43. Drug metabolizing enzyme induction of Nqo1 is reported in experimental fatty liver. PMID: 18488193
  44. The lack of induction of apoptosis and differentiation contributed to radiation-induced myeloproliferative disease in NQO1(-/-) mice. PMID: 18829548
  45. NQO1 modulates cellular redox status and influences the biologic and physiologic effects of ozone. PMID: 19059883
  46. It is concluded that cisplatin markedly increases the sensitivity of cancer to beta-lap in vitro and in vivo by upregulating NQO1. PMID: 19738461

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
NAD(P)H dehydrogenase (quinone) family
Database Links

KEGG: mmu:18104

STRING: 10090.ENSMUSP00000003947

UniGene: Mm.252

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*